PDB entry 2jwt

View 2jwt on RCSB PDB site
Description: Solution structure of Engrailed homeodomain WT
Class: transcription
Keywords: homeodomain, Developmental protein, DNA-binding, Homeobox, Nucleus, Phosphorylation, Repressor, Segmentation polarity protein, Transcription, Transcription regulation
Deposited on 2007-10-24, released 2008-04-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Segmentation polarity homeobox protein engrailed
  Species: Drosophila melanogaster [TaxId:7227]
  Gene: en
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02836 (1-60)
    • expression tag (0)
  Domains in SCOPe 2.06: d2jwta2, d2jwta3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jwtA (A:)
  mdekrprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnkrakikk
  s