PDB entry 2jv9

View 2jv9 on RCSB PDB site
Description: The Solution Structure of Calponin Homology Domain from Smoothelin-like 1
Class: structural protein, protein binding
Keywords: CH-domain, Smoothelin, Smoothelin-like 1, Calponin, Calponin homology domain, STRUCTURAL PROTEIN, PROTEIN BINDING
Deposited on 2007-09-12, released 2008-05-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Smoothelin-like 1
  Species: MUS MUSCULUS
  Gene: Smtnl1, RP23-399J8.5
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99LM3 (5-118)
    • expression tag (0-4)
  Domains in SCOPe 2.06: d2jv9a1, d2jv9a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jv9A (A:)
  gplgsknmllewcramtrnyehvdiqnfssswssgmafcalihkffpeafdyaeldpakr
  rhnftlafstaekladcaqllevddmvrlavpdskcvytyiqelyrslvqkglvktkkk