PDB entry 2jt3

View 2jt3 on RCSB PDB site
Description: Solution Structure of F153W cardiac troponin C
Class: structural protein
Keywords: EF-hand protein, Calcium-bind protein, Phe-to-Trp mutation, STRUCTURAL PROTEIN
Deposited on 2007-07-18, released 2007-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c
    Species: Homo sapiens [TaxId:9606]
    Gene: TNNC1, TNNC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63316 (0-160)
      • engineered (34)
      • engineered (83)
      • engineered (152)
    Domains in SCOPe 2.07: d2jt3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jt3A (A:)
    mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrsmkddskgkseeelsdlfrmfdknadgyidldelkim
    lqatgetiteddieelmkdgdknndgridydewlefmkgve