PDB entry 2jrt

View 2jrt on RCSB PDB site
Description: NMR solution structure of the protein coded by gene RHOS4_12090 of Rhodobacter sphaeroides. Northeast Structural Genomics target RhR5
Class: structural genomics, unknown function
Keywords: NMR Solution, Structure, NESG, PSI, target RhR5, Rhodobacter sphaeroides, Structural Genomics, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2007-06-28, released 2007-08-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Uncharacterized protein
  Species: Rhodobacter sphaeroides [TaxId:1063]
  Gene: RHOS4_12090, RSP_2620
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q3J357 (0-91)
    • cloning artifact (92-94)
  Domains in SCOPe 2.04: d2jrta_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jrtA (A:)
  mylkrvdgprqvtlpdgtvlsradlppldtrrwvasrkaavvkavihgliterealdrys
  lseeefalwrsavaahgekalkvtmiqkyrqlhhh