PDB entry 2jq4

View 2jq4 on RCSB PDB site
Description: Complete resonance assignments and solution structure calculation of ATC2521 (NESG ID: AtT6) from Agrobacterium tumefaciens
Class: structural genomics
Keywords: Agrobacterium tumefaciens, ATC2521, unknown function, ATC, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2007-05-29, released 2007-06-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-01-18, with a file datestamp of 2012-01-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein Atu2571
    Species: Agrobacterium tumefaciens [TaxId:358]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2jq4a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jq4A (A:)
    mgsshhhhhhssgrenlyfqghmnatireilakfgqlptpvdtiadeadlyaaglssfas
    vqlmlgieeafdiefpdnllnrksfasikaiedtvklildgkeaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jq4A (A:)
    mnatireilakfgqlptpvdtiadeadlyaaglssfasvqlmlgieeafdiefpdnllnr
    ksfasikaiedtvklildgkeaa