PDB entry 2jq4
View 2jq4 on RCSB PDB site
Description: Complete resonance assignments and solution structure calculation of ATC2521 (NESG ID: AtT6) from Agrobacterium tumefaciens
Class: structural genomics
Keywords: Agrobacterium tumefaciens, ATC2521, unknown function, ATC, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on
2007-05-29, released
2007-06-12
The last revision prior to the SCOPe 2.04 freeze date was dated
2012-01-18, with a file datestamp of
2012-01-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Hypothetical protein Atu2571
Species: Agrobacterium tumefaciens [TaxId:358]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d2jq4a1
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2jq4A (A:)
mgsshhhhhhssgrenlyfqghmnatireilakfgqlptpvdtiadeadlyaaglssfas
vqlmlgieeafdiefpdnllnrksfasikaiedtvklildgkeaa
Sequence, based on observed residues (ATOM records): (download)
>2jq4A (A:)
mnatireilakfgqlptpvdtiadeadlyaaglssfasvqlmlgieeafdiefpdnllnr
ksfasikaiedtvklildgkeaa