PDB entry 2jod

View 2jod on RCSB PDB site
Description: Pac1-Rshort N-terminal EC domain Pacap(6-38) complex
Class: signaling protein
Keywords: protein/peptide complex, SIGNALING PROTEIN
Deposited on 2007-03-07, released 2007-05-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pituitary adenylate cyclase-activating polypeptide type I receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ADCYAP1R1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41586 (5-105)
      • cloning artifact (0-4)
      • engineered (8)
    Domains in SCOPe 2.04: d2joda1
  • Chain 'B':
    Compound: Pituitary adenylate cyclase-activating polypeptide
    Species: Homo sapiens [TaxId:9606]
    Gene: ADCYAP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2jodb1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jodA (A:)
    mgsmahsdgifkkeqamclekiqranelmgfndsspgcpgmwdnitcwkpahvgemvlvs
    cpelfrifnpdqdmgvvsrnctedgwsepfphyfdacgfdeyeset
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jodB (B:)
    ftdsysryrkqmavkkylaavlgkrykqrvknk