PDB entry 2jnp

View 2jnp on RCSB PDB site
Description: Solution structure of matrix metalloproteinase 3 (MMP-3) in the presence of N-isobutyl-N-[4-methoxyphenylsulfonyl]glycyl hydroxamic acid (NNGH)
Class: hydrolase
Keywords: metalloproteinase, NMR, MMP, HYDROLASE
Deposited on 2007-01-30, released 2007-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Matrix metalloproteinase-3
  Species: Homo sapiens [TaxId:9606]
  Gene: MMP3, STMY1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08254 (0-160)
  Domains in SCOPe 2.07: d2jnpa_
• Heterogens: ZN, CA, NGH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jnpA (A:)
  gipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadimisfa
  vrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaaheighsl
  glfhsantealmyplyhsltdltrfrlsqddingiqslygp