PDB entry 2jn7

View 2jn7 on RCSB PDB site
Description: Northeast Structural Genomics Consortium Target ER411
Class: structural genomics, unknown function
Keywords: Hypothetical protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2006-12-28, released 2007-01-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein yfjZ
  Species: Escherichia coli [TaxId:562]
  Gene: yfjZ
  Database cross-references and differences (RAF-indexed):
  • Uniprot P52141 (0-104)
  Domains in SCOPe 2.08: d2jn7a1

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2jn7A (A:)
  msnttwglqrditprlgarlvqegnqlhyladrasitgkfsdaecpkldvvfphfisqie
  smlttgelnprhaqcvtlyhngftceadtlgscgyvyiavyptqrlehhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2jn7A (A:)
  msnttwglqrditprlgarlvqegnqlhyladrasitgkfsdaecpkldvvfphfisqie
  smlttgelnprhaqcvtlyhngftceadtlgscgyvyiavyptqr