Lineage for d2jn7a1 (2jn7 A:1-105)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2534513Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2535405Superfamily d.110.8: YeeU-like [143737] (1 family) (S)
    beta(2)-alpha-beta(3); 2 layers, a/b; there is an oligomerization interface instead of the 'missing' helical layer
    automatically mapped to Pfam PF06154
  5. 2535406Family d.110.8.1: YagB/YeeU/YfjZ-like [143738] (2 proteins)
    Pfam PF06154
  6. 2535414Protein Hypothetical protein YfjZ [143739] (1 species)
  7. 2535415Species Escherichia coli [TaxId:562] [143740] (2 PDB entries)
    Uniprot P52141 1-105
  8. 2535417Domain d2jn7a1: 2jn7 A:1-105 [138359]

Details for d2jn7a1

PDB Entry: 2jn7 (more details)

PDB Description: northeast structural genomics consortium target er411
PDB Compounds: (A:) protein yfjZ

SCOPe Domain Sequences for d2jn7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jn7a1 d.110.8.1 (A:1-105) Hypothetical protein YfjZ {Escherichia coli [TaxId: 562]}
msnttwglqrditprlgarlvqegnqlhyladrasitgkfsdaecpkldvvfphfisqie
smlttgelnprhaqcvtlyhngftceadtlgscgyvyiavyptqr

SCOPe Domain Coordinates for d2jn7a1:

Click to download the PDB-style file with coordinates for d2jn7a1.
(The format of our PDB-style files is described here.)

Timeline for d2jn7a1: