PDB entry 2jn3

View 2jn3 on RCSB PDB site
Description: NMR structure of cl-BABP complexed to chenodeoxycholic acid
Class: lipid binding protein
Keywords: bile acids, binding, nmr, lipid binding protein
Deposited on 2006-12-22, released 2007-07-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fatty acid-binding protein, liver
  Species: Gallus gallus [TaxId:9031]
  Gene: FABP1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80226 (0-124)
  Domains in SCOPe 2.08: d2jn3a_
• Heterogens: JN3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jn3A (A:)
  afsgtwqvyaqenyeeflkalalpedlikmardikpiveiqqkgddfvvtsktprqtvtn
  sftlgkeadittmdgkklkctvhlangklvtksekfsheqevkgnemvetitfggvtlir
  rskrv