PDB entry 2jn3

View 2jn3 on RCSB PDB site
Description: NMR structure of cl-BABP complexed to chenodeoxycholic acid
Class: lipid binding protein
Keywords: bile acids, binding, nmr, lipid binding protein
Deposited on 2006-12-22, released 2007-07-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty acid-binding protein, liver
    Species: Gallus gallus [TaxId:9031]
    Gene: FABP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2jn3a_
  • Heterogens: JN3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jn3A (A:)
    afsgtwqvyaqenyeeflkalalpedlikmardikpiveiqqkgddfvvtsktprqtvtn
    sftlgkeadittmdgkklkctvhlangklvtksekfsheqevkgnemvetitfggvtlir
    rskrv