Lineage for d2jn3a_ (2jn3 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804862Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2805152Protein Liver fatty acid binding protein [50866] (3 species)
  7. 2805153Species Chicken (Gallus gallus) [TaxId:9031] [256386] (5 PDB entries)
  8. 2805157Domain d2jn3a_: 2jn3 A: [148142]
    automated match to d1lida_
    complexed with jn3

Details for d2jn3a_

PDB Entry: 2jn3 (more details)

PDB Description: nmr structure of cl-babp complexed to chenodeoxycholic acid
PDB Compounds: (A:) Fatty acid-binding protein, liver

SCOPe Domain Sequences for d2jn3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jn3a_ b.60.1.2 (A:) Liver fatty acid binding protein {Chicken (Gallus gallus) [TaxId: 9031]}
afsgtwqvyaqenyeeflkalalpedlikmardikpiveiqqkgddfvvtsktprqtvtn
sftlgkeadittmdgkklkctvhlangklvtksekfsheqevkgnemvetitfggvtlir
rskrv

SCOPe Domain Coordinates for d2jn3a_:

Click to download the PDB-style file with coordinates for d2jn3a_.
(The format of our PDB-style files is described here.)

Timeline for d2jn3a_: