PDB entry 2jm6

View 2jm6 on RCSB PDB site
Description: Solution structure of MCL-1 complexed with NOXAB
Class: apoptosis
Keywords: apoptosis, mcl-1, bcl-2, helical bundle, bh3-only
Deposited on 2006-10-17, released 2007-03-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Noxa
    Species: Mus musculus [TaxId:10090]
    Gene: Pmaip1, Noxa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JM54 (0-25)
      • expression tag (26)
  • Chain 'B':
    Compound: Myeloid cell leukemia-1 protein Mcl-1 homolog
    Species: Mus musculus [TaxId:10090]
    Gene: MCL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P97287 (5-161)
      • expression tag (0-4)
    Domains in SCOPe 2.04: d2jm6b_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2jm6B (B:)
gplgseddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhe
tafqgmlrkldiknegdvksfsrvmvhvfkdgvtnwgrivtlisfgafvakhlksvnqes
fieplaetitdvlvrtkrdwlvkqrgwdgfveffhvqdlegg