SCOPe 2.07: Structural Classification of Proteins

PDB entry 2jfb

View 2jfb on RCSB PDB site
Description: 3d structure of lumazine synthase from candida albicans
Class: transferase
Keywords: transferase, candida albicans, lumazine synthase, riboflavin biosynthesis
Deposited on 2007-01-30, released 2007-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.213
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: 6,7-dimethyl-8-ribityllumazine synthase
Species: Candida albicans [TaxId:5476]
Database cross-references and differences (RAF-indexed):
- PDB 2JFB (Start-163)
Domains in SCOPe 2.07: d2jfba_
Chain 'B':
Compound: 6,7-dimethyl-8-ribityllumazine synthase
Species: Candida albicans [TaxId:5476]
Database cross-references and differences (RAF-indexed):
- PDB 2JFB (Start-163)
Domains in SCOPe 2.07: d2jfbb_
Chain 'C':
Compound: 6,7-dimethyl-8-ribityllumazine synthase
Species: Candida albicans [TaxId:5476]
Database cross-references and differences (RAF-indexed):
- PDB 2JFB (Start-163)
Domains in SCOPe 2.07: d2jfbc_
Chain 'D':
Compound: 6,7-dimethyl-8-ribityllumazine synthase
Species: Candida albicans [TaxId:5476]
Database cross-references and differences (RAF-indexed):
- PDB 2JFB (Start-163)
Domains in SCOPe 2.07: d2jfbd_
Chain 'E':
Compound: 6,7-dimethyl-8-ribityllumazine synthase
Species: Candida albicans [TaxId:5476]
Database cross-references and differences (RAF-indexed):
- PDB 2JFB (Start-163)
Domains in SCOPe 2.07: d2jfbe_
Chain 'F':
Compound: 6,7-dimethyl-8-ribityllumazine synthase
Species: Candida albicans [TaxId:5476]
Database cross-references and differences (RAF-indexed):
- PDB 2JFB (Start-163)
Domains in SCOPe 2.07: d2jfbf_
Chain 'G':
Compound: 6,7-dimethyl-8-ribityllumazine synthase
Species: Candida albicans [TaxId:5476]
Database cross-references and differences (RAF-indexed):
- PDB 2JFB (Start-163)
Domains in SCOPe 2.07: d2jfbg_
Chain 'H':
Compound: 6,7-dimethyl-8-ribityllumazine synthase
Species: Candida albicans [TaxId:5476]
Database cross-references and differences (RAF-indexed):
- PDB 2JFB (Start-163)
Domains in SCOPe 2.07: d2jfbh_
Chain 'I':
Compound: 6,7-dimethyl-8-ribityllumazine synthase
Species: Candida albicans [TaxId:5476]
Database cross-references and differences (RAF-indexed):
- PDB 2JFB (Start-163)
Domains in SCOPe 2.07: d2jfbi_
Chain 'J':
Compound: 6,7-dimethyl-8-ribityllumazine synthase
Species: Candida albicans [TaxId:5476]
Database cross-references and differences (RAF-indexed):
- PDB 2JFB (Start-163)
Domains in SCOPe 2.07: d2jfbj_
Chain 'K':
Compound: 6,7-dimethyl-8-ribityllumazine synthase
Species: Candida albicans [TaxId:5476]
Database cross-references and differences (RAF-indexed):
- PDB 2JFB (Start-163)
Domains in SCOPe 2.07: d2jfbk_
Chain 'L':
Compound: 6,7-dimethyl-8-ribityllumazine synthase
Species: Candida albicans [TaxId:5476]
Database cross-references and differences (RAF-indexed):
- PDB 2JFB (Start-163)
Domains in SCOPe 2.07: d2jfbl_
Chain 'M':
Compound: 6,7-dimethyl-8-ribityllumazine synthase
Species: Candida albicans [TaxId:5476]
Database cross-references and differences (RAF-indexed):
- PDB 2JFB (Start-163)
Domains in SCOPe 2.07: d2jfbm_
Chain 'N':
Compound: 6,7-dimethyl-8-ribityllumazine synthase
Species: Candida albicans [TaxId:5476]
Database cross-references and differences (RAF-indexed):
- PDB 2JFB (Start-163)
Domains in SCOPe 2.07: d2jfbn_
Chain 'O':
Compound: 6,7-dimethyl-8-ribityllumazine synthase
Species: Candida albicans [TaxId:5476]
Database cross-references and differences (RAF-indexed):
- PDB 2JFB (Start-163)
Domains in SCOPe 2.07: d2jfbo_
Heterogens: PO4, MPD, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>2jfbA (A:)
mavkglgevdqkydgsklrigilharwnrkiidalvagavkrlqefgvkeeniiietvpg
sfelpygsklfvekqkrlgkpldaiipigvlikgstmhfeyicdstthqlmklnfelgip
vifgvltcltdeqaearagliegkmhnhgedwgaaavematkfn