PDB entry 2j7z

View 2j7z on RCSB PDB site
Description: crystal structure of recombinant human stromal cell-derived factor-1alpha
Class: growth factor
Keywords: growth factor, alternative splicing, cxcr4, cytokine, refolding, chemotaxis, sdf-1alpha
Deposited on 2006-10-18, released 2006-10-23
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.213
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: stromal cell-derived factor 1 alpha
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2j7za1
  • Chain 'B':
    Compound: stromal cell-derived factor 1 alpha
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2j7zb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j7zA (A:)
    kpvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqe
    ylekalnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j7zB (B:)
    kpvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqe
    ylekalnk