Lineage for d2j7za1 (2j7z A:1-67)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716158Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 716159Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
    form dimers with different dimerisation modes
  5. 716160Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins)
  6. 716360Protein Stromal cell-derived factor-1 (SDF-1) [54150] (1 species)
  7. 716361Species Human (Homo sapiens) [TaxId:9606] [54151] (6 PDB entries)
  8. 716362Domain d2j7za1: 2j7z A:1-67 [138131]
    automatically matched to d1sdf__

Details for d2j7za1

PDB Entry: 2j7z (more details), 1.95 Å

PDB Description: crystal structure of recombinant human stromal cell-derived factor-1alpha
PDB Compounds: (A:) stromal cell-derived factor 1 alpha

SCOP Domain Sequences for d2j7za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j7za1 d.9.1.1 (A:1-67) Stromal cell-derived factor-1 (SDF-1) {Human (Homo sapiens) [TaxId: 9606]}
kpvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqe
ylekaln

SCOP Domain Coordinates for d2j7za1:

Click to download the PDB-style file with coordinates for d2j7za1.
(The format of our PDB-style files is described here.)

Timeline for d2j7za1: