PDB entry 2j72

View 2j72 on RCSB PDB site
Description: alpha-glucan recognition by a family 41 carbohydrate-binding module from Thermotoga maritima pullulanase PulA
Class: hydrolase
Keywords: carbohydrate-binding module, hydrolase, glycosidase, maltotetraose, beta- sandwich fold, alpha-glucan binding
Deposited on 2006-10-05, released 2006-10-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pullulanase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33840 (Start-102)
      • conflict (1)
    Domains in SCOPe 2.08: d2j72a_
  • Chain 'B':
    Compound: pullulanase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33840 (0-102)
      • conflict (1)
    Domains in SCOPe 2.08: d2j72b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2j72A (A:)
ftettivvhyhrydgkydgwnlwiwpvepvsqegkayqftgeddfgkvavvklpmdltkv
giivrlnewqakdvakdrfieikdgkaevwilqgveeifyekp

    Sequence, based on observed residues (ATOM records): (download) 
    >2j72A (A:)
tettivvhyhrydgkydgwnlwiwpvepvsqegkayqftgeddfgkvavvklpmdltkvg
iivrlnewqakdvakdrfieikdgkaevwilqgveeifyekp

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2j72B (B:)
ftettivvhyhrydgkydgwnlwiwpvepvsqegkayqftgeddfgkvavvklpmdltkv
giivrlnewqakdvakdrfieikdgkaevwilqgveeifyekp