Lineage for d2j72a_ (2j72 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768598Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2768717Family b.3.1.3: PUD-like [158932] (1 protein)
    Pfam PF03714; bacterial pullanase-associated domain
  6. 2768718Protein Pullulanase PulA [158933] (4 species)
  7. 2768731Species Thermotoga maritima [TaxId:2336] [158937] (3 PDB entries)
    Uniprot O33840 19-102
  8. 2768734Domain d2j72a_: 2j72 A: [147897]
    automated match to d2j71a1

Details for d2j72a_

PDB Entry: 2j72 (more details), 1.49 Å

PDB Description: alpha-glucan recognition by a family 41 carbohydrate-binding module from thermotoga maritima pullulanase pula
PDB Compounds: (A:) pullulanase

SCOPe Domain Sequences for d2j72a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j72a_ b.3.1.3 (A:) Pullulanase PulA {Thermotoga maritima [TaxId: 2336]}
tettivvhyhrydgkydgwnlwiwpvepvsqegkayqftgeddfgkvavvklpmdltkvg
iivrlnewqakdvakdrfieikdgkaevwilqgveeifyekp

SCOPe Domain Coordinates for d2j72a_:

Click to download the PDB-style file with coordinates for d2j72a_.
(The format of our PDB-style files is described here.)

Timeline for d2j72a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2j72b_