PDB entry 2j12

View 2j12 on RCSB PDB site
Description: Ad37 fibre head in complex with CAR D1
Class: viral protein/receptor
Keywords: viral protein-receptor complex, car, ad37, had37, complex, membrane, receptor, coxsackievirus, phosphorylation, immunoglobulin domain, host-virus interaction, cell adhesion, transmembrane, tight junction, palmitate, adenovirus, lipoprotein, glycoprotein
Deposited on 2006-08-08, released 2006-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fiber protein
    Species: Human adenovirus D37 [TaxId:52275]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J12
    • Uniprot Q64823 (Start-193)
    Domains in SCOPe 2.07: d2j12a_
  • Chain 'B':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j12b_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j12A (A:)
    gamgswnpkydtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyh
    iinnktnpkiksftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlv
    aypkpsnskkyardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenve
    fettsftfsyiaqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j12A (A:)
    rtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpkiks
    ftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskkya
    rdivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsyia
    qe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j12B (B:)
    madfarslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqvii
    lysgdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankk
    ihlvvlvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j12B (B:)
    slsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdk
    iyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvl