SCOPe 2.05: Structural Classification of Proteins

PDB entry 2j00

View 2j00 on RCSB PDB site
Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 1 of 4). This file contains the 30s subunit, mrna, a-, p- and e-site trnas and paromomycin for molecule I.
Class: ribosome
Keywords: ribosome, tRNA, paromomycin, mRNA, translation
Deposited on 2006-07-31, released 2006-09-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2715
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: 16s rRNA
Species: Thermus thermophilus [TaxId:300852]
Chain 'B':
Compound: 30S ribosomal protein S2
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- PDB 2J00
- Uniprot P80371
Domains in SCOPe 2.05: d2j00b1
Chain 'C':
Compound: 30S ribosomal protein S3
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- PDB 2J00
- Uniprot P80372 (1-End)
Domains in SCOPe 2.05: d2j00c1, d2j00c2
Chain 'D':
Compound: 30S ribosomal protein S4
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- PDB 2J00
- Uniprot P80373 (1-208)
Domains in SCOPe 2.05: d2j00d1
Chain 'E':
Compound: 30S ribosomal protein S5
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- PDB 2J00
- Uniprot Q5SHQ5
Domains in SCOPe 2.05: d2j00e1, d2j00e2
Chain 'F':
Compound: 30S ribosomal protein S6
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SLP8 (0-100)
Domains in SCOPe 2.05: d2j00f1
Chain 'G':
Compound: 30S ribosomal protein S7
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- PDB 2J00
- Uniprot P17291 (1-155)
Domains in SCOPe 2.05: d2j00g1
Chain 'H':
Compound: 30S ribosomal protein S8
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SHQ2 (0-137)
Domains in SCOPe 2.05: d2j00h1
Chain 'I':
Compound: 30S ribosomal protein S9
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot P62669 (Start-127)
Domains in SCOPe 2.05: d2j00i1
Chain 'J':
Compound: 30S ribosomal protein S10
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- PDB 2J00
- Uniprot Q5SHN7
Domains in SCOPe 2.05: d2j00j1
Chain 'K':
Compound: 30S ribosomal protein S11
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- PDB 2J00
- Uniprot P80376 (Start-128)
Domains in SCOPe 2.05: d2j00k1
Chain 'L':
Compound: 30S ribosomal protein S12
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- PDB 2J00
- Uniprot Q5SHN3 (4-End)
Domains in SCOPe 2.05: d2j00l1
Chain 'M':
Compound: 30S ribosomal protein S13
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- PDB 2J00
- Uniprot P80377 (1-125)
Domains in SCOPe 2.05: d2j00m1
Chain 'N':
Compound: 30S ribosomal protein S14
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- PDB 2J00
- Uniprot Q5SHQ1 (1-60)
Domains in SCOPe 2.05: d2j00n1
Chain 'O':
Compound: 30S ribosomal protein S15
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- PDB 2J00
- Uniprot Q5SJ76 (1-88)
Domains in SCOPe 2.05: d2j00o1
Chain 'P':
Compound: 30S ribosomal protein S16
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SJH3 (0-End)
Domains in SCOPe 2.05: d2j00p1
Chain 'Q':
Compound: 30S ribosomal protein S17
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- PDB 2J00
- Uniprot Q5SHP7 (1-End)
Domains in SCOPe 2.05: d2j00q1
Chain 'R':
Compound: 30S ribosomal protein S18
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- PDB 2J00
- Uniprot Q5SLQ0 (Start-87)
Domains in SCOPe 2.05: d2j00r1
Chain 'S':
Compound: 30S ribosomal protein S19
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- PDB 2J00
- Uniprot Q5SHP2
Domains in SCOPe 2.05: d2j00s1
Chain 'T':
Compound: 30S ribosomal protein S20
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- PDB 2J00
- Uniprot P80380 (Start-105)
Domains in SCOPe 2.05: d2j00t1
Chain 'U':
Compound: 30S ribosomal protein Thx
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- PDB 2J00
- Uniprot Q5SIH3 (1-End)
Domains in SCOPe 2.05: d2j00u1
Chain 'V':
Compound: p-site tRNA fmet (unmodified bases except for thymine 54)
Species: Escherichia coli [TaxId:83333]
Chain 'W':
Compound: e-site tRNA phe or a-site tRNA phe (unmodified bases)
Species: Escherichia coli [TaxId:83333]
Chain 'X':
Compound: mRNA
Chain 'Y':
Compound: e-site tRNA phe or a-site tRNA phe (unmodified bases)
Species: Escherichia coli [TaxId:83333]
Heterogens: MG, ZN, PAR

PDB Chain Sequences:

Chain 'A':
No sequence available.

Chain 'B':
Sequence, based on SEQRES records: (download)

>2j00B (B:)
mpveitvkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfied
lamrggtilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelea
lfaspeieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearkl
fipvialadtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
eaeatetpegesevea