Lineage for d2j00t1 (2j00 T:8-106)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1724371Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1724538Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
    automatically mapped to Pfam PF01649
  5. 1724539Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 1724540Protein Ribosomal protein S20 [46994] (2 species)
  7. 1724568Species Thermus thermophilus [TaxId:274] [46995] (45 PDB entries)
    Uniprot P80380
  8. 1724591Domain d2j00t1: 2j00 T:8-106 [137858]
    Other proteins in same PDB: d2j00b1, d2j00c1, d2j00c2, d2j00d1, d2j00e1, d2j00e2, d2j00f1, d2j00g1, d2j00h1, d2j00i1, d2j00j1, d2j00k1, d2j00l1, d2j00m1, d2j00n1, d2j00o1, d2j00p1, d2j00q1, d2j00r1, d2j00s1, d2j00u1
    protein/RNA complex; complexed with mg, par, zn
    protein/RNA complex; complexed with mg, par, zn

Details for d2j00t1

PDB Entry: 2j00 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 1 of 4). This file contains the 30s subunit, mrna, a-, p- and e-site trnas and paromomycin for molecule I.
PDB Compounds: (T:) 30S ribosomal protein S20

SCOPe Domain Sequences for d2j00t1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j00t1 a.7.6.1 (T:8-106) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]}
rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOPe Domain Coordinates for d2j00t1:

Click to download the PDB-style file with coordinates for d2j00t1.
(The format of our PDB-style files is described here.)

Timeline for d2j00t1: