PDB entry 2izm

View 2izm on RCSB PDB site
Description: ms2-RNA hairpin (c-10) complex
Class: virus/RNA
Keywords: virus/RNA, virus/viral protein/RNA, complex (capsid protein-RNA hairpin), virion protein, capsid protein, structural protein, capsid, hairpin, levivirus, RNA-binding
Deposited on 2006-07-25, released 2007-07-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.246
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ms2 coat protein
    Species: BACTERIOPHAGE MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2izma_
  • Chain 'B':
    Compound: ms2 coat protein
    Species: BACTERIOPHAGE MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2izmb_
  • Chain 'C':
    Compound: ms2 coat protein
    Species: BACTERIOPHAGE MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2izmc_
  • Chain 'R':
    Compound: 5'-r(*ap*cp*ap*up*gp*cp*gp*gp*ap*up *cp*ap*cp*cp*cp*ap*up*gp*u)-3'
    Species: BACTERIOPHAGE MS2, synthetic [TaxId:12022]
  • Chain 'S':
    Compound: 5'-r(*ap*cp*ap*up*gp*cp*gp*gp*ap*up *cp*ap*cp*cp*cp*ap*up*gp*u)-3'
    Species: BACTERIOPHAGE MS2, synthetic [TaxId:12022]
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2izmA (A:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2izmB (B:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2izmC (C:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.