PDB entry 2iz9
View 2iz9 on RCSB PDB site
Description: ms2-RNA hairpin (4one-5) complex
Class: virus/RNA
Keywords: virus/RNA, hairpin, capsid, levivirus, virus, complex (capsid protein/RNA hairpin)
Deposited on
2006-07-25, released
2006-07-27
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.2
AEROSPACI score: 0.27
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ms2 coat protein
Species: Enterobacterio phage MS2 [TaxId:12022]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2iz9a_ - Chain 'B':
Compound: ms2 coat protein
Species: Enterobacterio phage MS2 [TaxId:12022]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2iz9b_ - Chain 'C':
Compound: ms2 coat protein
Species: Enterobacterio phage MS2 [TaxId:12022]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2iz9c_ - Chain 'R':
Compound: 5'-r(*ap*cp*ap*up*gp*ap*gp*gp*ap*u onep *ap*cp*cp*cp*ap*up*gp*u)-3'
Species: ENTEROBACTERIO PHAGE MS2, synthetic [TaxId:12022]
- Chain 'S':
Compound: 5'-r(*ap*cp*ap*up*gp*ap*gp*gp*ap*u onep *ap*cp*cp*cp*ap*up*gp*u)-3'
Species: ENTEROBACTERIO PHAGE MS2, synthetic [TaxId:12022]
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2iz9A (A:)
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2iz9B (B:)
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>2iz9C (C:)
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy
- Chain 'R':
No sequence available.
- Chain 'S':
No sequence available.