PDB entry 2itg

View 2itg on RCSB PDB site
Description: catalytic domain of hiv-1 integrase: ordered active site in the f185h construct
Deposited on 1996-09-13, released 1997-03-12
The last revision prior to the SCOP 1.61 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.2
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d2itg__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2itg_ (-)
hgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpv
ktvhtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqae
hlktavqmavfihnhkrkggiggysagerivdiiatdiqt