PDB entry 2in2

View 2in2 on RCSB PDB site
Description: NMR Structure of the Apo Human Rhinovirus 3C Protease (serotype 14)
Class: hydrolase
Keywords: Hydrolase, Protease, Beta Barrel, RNA binding, RNA polymerase binding
Deposited on 2006-10-05, released 2006-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-05-13, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: picornain 3c
    Species: Human rhinovirus 14 [TaxId:12131]
    Gene: HRV-3ABC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2in2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2in2A (A:)
gpntefalsllrknimtittskgeftglgihdrvcvipthaqpgddvlvngqkirvkdky
klvdpeninleltvltldrnekfrdirgfisedlegvdatlvvhsnnftntilevgpvtm
aglinlsstptnrmirydyatktgqcggvlcatgkifgihvggngrqgfsaqlkkqyfve
kq