PDB entry 2il4
View 2il4 on RCSB PDB site
Description: Crystal structure of At1g77540-Coenzyme A Complex
Class: transferase
Keywords: CoA, Coenzyme-A, COG2388 Family, acetyltransferase, At1g77540, STRUCTURAL GENOMICS FUNCTIONAL FOLLOW-UP STUDY, PROTEIN STRUCTURE INITIATIVE, PSI, CENTER FOR EUKARYOTIC STRUCTURAL GENOMICS, CESG, TRANSFERASE
Deposited on
2006-10-02, released
2006-10-17
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.166
AEROSPACI score: 0.45
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protein At1g77540
Species: Arabidopsis thaliana [TaxId:3702]
Gene: At1g77540
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2il4a_ - Heterogens: COA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2il4A (A:)
mateppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcva
afehasshsisiipscsyvsdtflprnpswkplihsevfkssi
Sequence, based on observed residues (ATOM records): (download)
>2il4A (A:)
pkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcvaafeha
sshsisiipscsyvsdtflprnpswkplih