PDB entry 2ihl

View 2ihl on RCSB PDB site
Description: lysozyme (e.c.3.2.1.17) (japanese quail)
Class: hydrolase(o-glycosyl)
Keywords: hydrolase(o-glycosyl)
Deposited on 1993-06-29, released 1994-01-31
The last revision prior to the SCOP 1.75 freeze date was dated 1994-01-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.165
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: japanese quail egg white lysozyme
    Species: Coturnix coturnix japonica
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ihla_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ihlA (A:)
    kvygrcelaaamkrhgldkyqgyslgnwvcaakfesnfntqatnrntdgstdygilqins
    rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdvhgmnawvawrnrckgtdv
    nawirgcrl