Lineage for d2ihla_ (2ihl A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 850027Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 850028Superfamily d.2.1: Lysozyme-like [53955] (11 families) (S)
  5. 850037Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 850101Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 850656Species Japanese quail (Coturnix coturnix japonica) [TaxId:93934] [53967] (1 PDB entry)
  8. 850657Domain d2ihla_: 2ihl A: [36408]
    complexed with na

Details for d2ihla_

PDB Entry: 2ihl (more details), 1.4 Å

PDB Description: lysozyme (e.c.3.2.1.17) (japanese quail)
PDB Compounds: (A:) japanese quail egg white lysozyme

SCOP Domain Sequences for d2ihla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ihla_ d.2.1.2 (A:) Lysozyme {Japanese quail (Coturnix coturnix japonica) [TaxId: 93934]}
kvygrcelaaamkrhgldkyqgyslgnwvcaakfesnfntqatnrntdgstdygilqins
rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdvhgmnawvawrnrckgtdv
nawirgcrl

SCOP Domain Coordinates for d2ihla_:

Click to download the PDB-style file with coordinates for d2ihla_.
(The format of our PDB-style files is described here.)

Timeline for d2ihla_: