PDB entry 2if5

View 2if5 on RCSB PDB site
Description: Structure of the POZ domain of human LRF, a master regulator of oncogenesis
Class: transcription
Keywords: POZ domain, BTB domain, POK, proto oncogene, transcription factor, TRANSCRIPTION
Deposited on 2006-09-20, released 2006-11-21
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.232
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger and BTB domain-containing protein 7A
    Species: Homo sapiens [TaxId:9606]
    Gene: ZBTB7A, FBI1, LRF, ZBTB7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2if5a_
  • Heterogens: PR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2if5A (A:)
    igipfpdhssdilsglneqrtqgllcdvvilvegrefpthrsvlaacsqyfkklftsgav
    vdqqnvyeidfvsaealtalmdfaytatltvstanvgdilsaarlleipavshvcadlld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2if5A (A:)
    igipfpdhssdilsglneqrtqgllcdvvilvegrefpthrsvlaacsqyfkklftsqqn
    vyeidfvsaealtalmdfaytatltvstanvgdilsaarlleipavshvcadlld