PDB entry 2ic1

View 2ic1 on RCSB PDB site
Description: Crystal Structure of Human Cysteine Dioxygenase in Complex with Substrate Cysteine
Class: oxidoreductase
Keywords: cupin, enzyme-substrate complex, OXIDOREDUCTASE
Deposited on 2006-09-12, released 2006-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.178
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine dioxygenase type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Cdo1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ic1a1
  • Heterogens: FE2, CYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ic1A (A:)
    gplgsmeqtevlkprtladlirilhqlfagdevnveevqaimeayesdptewamyakfdq
    yrytrnlvdqgngkfnlmilcwgeghgssihdhtnshcflkmlqgnlketlfawpdkksn
    emvkkservlrenqcayindsiglhrvenishtepavslhlysppfdtchafdqrtghkn
    kvtmtfhskfgirtpnatsgslenn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ic1A (A:)
    vlkprtladlirilhqlfagdevnveevqaimeayesdptewamyakfdqyrytrnlvdq
    gngkfnlmilcwgeghgssihdhtnshcflkmlqgnlketlfawpdkksnemvkkservl
    renqcayindsiglhrvenishtepavslhlysppfdtchafdqrtghknkvtmtfhskf
    girtp