PDB entry 2iag

View 2iag on RCSB PDB site
Description: Crystal structure of human prostacyclin synthase
Class: isomerase
Keywords: prostacyclin synthase, Class III cytochorme P450, hemoprotein, CYP8A1, ISOMERASE
Deposited on 2006-09-08, released 2006-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.204
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prostacyclin synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: PTGIS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16647 (0-477)
      • expression tag (478)
    Domains in SCOPe 2.07: d2iaga1, d2iaga2
  • Chain 'B':
    Compound: Prostacyclin synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: PTGIS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16647 (0-477)
      • expression tag (478-479)
    Domains in SCOPe 2.07: d2iagb1, d2iagb2
  • Heterogens: NA, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iagA (A:)
    rtrrpgeppldlgsipwlgyaldfgkdaasfltrmkekhgdiftilvggryvtvlldphs
    ydavvweprtrldfhayaiflmerifdvqlphyspsdekarmkltllhrelqalteamyt
    nlhavllgdateagsgwhemglldfsysfllragyltlygiealprthesqaqdrvhsad
    vfhtfrqldrllpklargslsvgdkdhmcsvksrlwkllsparlarrahrskwlesyllh
    leemgvseemqaralvlqlwatqgnmgpaafwlllfllknpealaavrgelesilwqaeq
    pvsqtttlpqkvldstpvldsvlseslrltaapfitrevvvdlampmadgrefnlrrgdr
    lllfpflspqrdpeiytdpevfkynrflnpdgsekkdfykdgkrlknynmpwgaghnhcl
    grsyavnsikqfvflvlvhldlelinadveipefdlsrygfglmqpehdvpvryrirphh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iagA (A:)
    rtrrpgeppldlgsipwlgyaldfgkdaasfltrmkekhgdiftilvggryvtvlldphs
    ydavvweprtrldfhayaiflmerifdvqlphyspsdekarmkltllhrelqalteamyt
    nlhavllgdateagsgwhemglldfsysfllragyltlygiealprthesqaqdrvhsad
    vfhtfrqldrllpklargslsvgdkdhmcsvksrlwkllsparlarrahrskwlesyllh
    leemgvseemqaralvlqlwatqgnmgpaafwlllfllknpealaavrgelesilwqttl
    pqkvldstpvldsvlseslrltaapfitrevvvdlampmadgrefnlrrgdrlllfpfls
    pqrdpeiytdpevfkynrflnpdgsekkdfykdgkrlknynmpwgaghnhclgrsyavns
    ikqfvflvlvhldlelinadveipefdlsrygfglmqpehdvpvryrirph
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iagB (B:)
    rtrrpgeppldlgsipwlgyaldfgkdaasfltrmkekhgdiftilvggryvtvlldphs
    ydavvweprtrldfhayaiflmerifdvqlphyspsdekarmkltllhrelqalteamyt
    nlhavllgdateagsgwhemglldfsysfllragyltlygiealprthesqaqdrvhsad
    vfhtfrqldrllpklargslsvgdkdhmcsvksrlwkllsparlarrahrskwlesyllh
    leemgvseemqaralvlqlwatqgnmgpaafwlllfllknpealaavrgelesilwqaeq
    pvsqtttlpqkvldstpvldsvlseslrltaapfitrevvvdlampmadgrefnlrrgdr
    lllfpflspqrdpeiytdpevfkynrflnpdgsekkdfykdgkrlknynmpwgaghnhcl
    grsyavnsikqfvflvlvhldlelinadveipefdlsrygfglmqpehdvpvryrirphh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iagB (B:)
    rtrrpgeppldlgsipwlgyaldfgkdaasfltrmkekhgdiftilvggryvtvlldphs
    ydavvweprtrldfhayaiflmerifdvqlphyspsdekarmkltllhrelqalteamyt
    nlhavllgdateagsgwhemglldfsysfllragyltlygiealprthesqaqdrvhsad
    vfhtfrqldrllpklargslsvgdkdhmcsvksrlwkllsparlarrahrskwlesyllh
    leemgvseemqaralvlqlwatqgnmgpaafwlllfllknpealaavrgelesilwpqkv
    ldstpvldsvlseslrltaapfitrevvvdlampmadgrefnlrrgdrlllfpflspqrd
    peiytdpevfkynrflnpdgsekkdfykdgkrlknynmpwgaghnhclgrsyavnsikqf
    vflvlvhldlelinadveipefdlsrygfglmqpehdvpvryrirphh