Lineage for d2iagb1 (2iag B:23-500)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005573Species Human (Homo sapiens) [TaxId:9606] [196470] (36 PDB entries)
  8. 2005620Domain d2iagb1: 2iag B:23-500 [230786]
    Other proteins in same PDB: d2iaga2, d2iagb2
    automated match to d3b99a_
    complexed with hem, na

Details for d2iagb1

PDB Entry: 2iag (more details), 2.15 Å

PDB Description: Crystal structure of human prostacyclin synthase
PDB Compounds: (B:) Prostacyclin synthase

SCOPe Domain Sequences for d2iagb1:

Sequence, based on SEQRES records: (download)

>d2iagb1 a.104.1.0 (B:23-500) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtrrpgeppldlgsipwlgyaldfgkdaasfltrmkekhgdiftilvggryvtvlldphs
ydavvweprtrldfhayaiflmerifdvqlphyspsdekarmkltllhrelqalteamyt
nlhavllgdateagsgwhemglldfsysfllragyltlygiealprthesqaqdrvhsad
vfhtfrqldrllpklargslsvgdkdhmcsvksrlwkllsparlarrahrskwlesyllh
leemgvseemqaralvlqlwatqgnmgpaafwlllfllknpealaavrgelesilwqaeq
pvsqtttlpqkvldstpvldsvlseslrltaapfitrevvvdlampmadgrefnlrrgdr
lllfpflspqrdpeiytdpevfkynrflnpdgsekkdfykdgkrlknynmpwgaghnhcl
grsyavnsikqfvflvlvhldlelinadveipefdlsrygfglmqpehdvpvryrirp

Sequence, based on observed residues (ATOM records): (download)

>d2iagb1 a.104.1.0 (B:23-500) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtrrpgeppldlgsipwlgyaldfgkdaasfltrmkekhgdiftilvggryvtvlldphs
ydavvweprtrldfhayaiflmerifdvqlphyspsdekarmkltllhrelqalteamyt
nlhavllgdateagsgwhemglldfsysfllragyltlygiealprthesqaqdrvhsad
vfhtfrqldrllpklargslsvgdkdhmcsvksrlwkllsparlarrahrskwlesyllh
leemgvseemqaralvlqlwatqgnmgpaafwlllfllknpealaavrgelesilwpqkv
ldstpvldsvlseslrltaapfitrevvvdlampmadgrefnlrrgdrlllfpflspqrd
peiytdpevfkynrflnpdgsekkdfykdgkrlknynmpwgaghnhclgrsyavnsikqf
vflvlvhldlelinadveipefdlsrygfglmqpehdvpvryrirp

SCOPe Domain Coordinates for d2iagb1:

Click to download the PDB-style file with coordinates for d2iagb1.
(The format of our PDB-style files is described here.)

Timeline for d2iagb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iagb2