PDB entry 2iaf

View 2iaf on RCSB PDB site
Description: Crystal structure of a fragment (residues 11 to 161) of L-serine dehydratase from Legionella pneumophila
Class: structural genomics, unknown function
Keywords: MCSG, PSI2, MAD, STRUCTURAL GENOMICS, L-serine dehydratase, Protein Structure Initiative, Midwest Center for Structural Genomics, unknown function
Deposited on 2006-09-07, released 2006-10-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.196
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein sdhL
    Species: Legionella pneumophila [TaxId:446]
    Gene: sdhL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5WYB1 (Start-150)
      • modified residue (13)
      • modified residue (73)
      • modified residue (77)
      • modified residue (117)
    Domains in SCOPe 2.06: d2iafa1
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2iafA (A:)
igigpssshtvgpmlaanaflqlleqknlfdktqrvkvelygslaltgkghgtdkailng
lenkapetvdpasmiprmheildsnllnlagkkeipfheatdflflqkellpkhsngmrf
safdgnanllieqvyysigggfitteedfdk

    Sequence, based on observed residues (ATOM records): (download) 
    >2iafA (A:)
sshtvgpmlaanaflqlleqknlfdktqrvkvelygslaltgkghgtdkailnglenkap
esmiprmheildsnllnlagkkeipfheatdflflqkellpkhsngmrfsafdgnanlli
eqvyysigggfitteedfdk