PDB entry 2i59

View 2i59 on RCSB PDB site
Description: Solution structure of RGS10
Class: signaling protein
Keywords: Regulator of G-protein signaling, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2006-08-24, released 2006-10-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Regulator of G-protein signaling 10
  Species: Homo sapiens [TaxId:9606]
  Gene: RGS10
  Database cross-references and differences (RAF-indexed):
  • Uniprot O43665 (2-137)
    • cloning artifact (0-1)
  Domains in SCOPe 2.04: d2i59a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2i59A (A:)
  smqslkstakwaaslenlledpegvkrfreflkkefseenvlfwlacedfkkmqdktqmq
  ekakeiymtflsskassqvnvegqsrlnekileephplmfqklqdqifnlmkydsysrfl
  ksdlflkhkrteeeeedl