PDB entry 2i4a

View 2i4a on RCSB PDB site
Description: Crystal structure of thioredoxin from the acidophile Acetobacter aceti
Class: oxidoreductase
Keywords: thioredoxin, acidophile, disulfide exchange, OXIDOREDUCTASE
Deposited on 2006-08-21, released 2007-01-09
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.135
AEROSPACI score: 1.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thioredoxin
  Species: Acetobacter aceti [TaxId:435]
  Database cross-references and differences (RAF-indexed):
  • PDB 2I4A (0-106)
  Domains in SCOPe 2.02: d2i4aa_
• Heterogens: BME, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2i4aA (A:)
  sehtlavsdssfdqdvlkasglvlvdfwaewcgpckmigpalgeigkefagkvtvakvni
  ddnpetpnayqvrsiptlmlvrdgkvidkkvgalpksqlkawvesaq