PDB entry 2i1n
View 2i1n on RCSB PDB site
Description: Crystal structure of the 1st PDZ domain of Human DLG3
Class: signaling protein
Keywords: DLG3, PDZ, PDZ domain, signal transduction, structural genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on
2006-08-14, released
2006-09-05
The last revision prior to the SCOPe 2.04 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.187
AEROSPACI score: 0.5
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Discs, large homolog 3
Species: Homo sapiens [TaxId:9606]
Gene: DLG3
Database cross-references and differences (RAF-indexed):
- Uniprot Q5JUW7 (1-97)
- cloning artifact (98-101)
Domains in SCOPe 2.04: d2i1na_ - Chain 'B':
Compound: Discs, large homolog 3
Species: Homo sapiens [TaxId:9606]
Gene: DLG3
Database cross-references and differences (RAF-indexed):
- Uniprot Q5JUW7 (1-97)
- cloning artifact (0)
- cloning artifact (98-101)
Domains in SCOPe 2.04: d2i1nb_ - Heterogens: NA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2i1nA (A:)
smfkyeeivlergnsglgfsiaggidnphvpddpgifitkiipggaaamdgrlgvndcvl
rvnevdvsevvhsravealkeagpvvrlvvrrrqpppeetsv
Sequence, based on observed residues (ATOM records): (download)
>2i1nA (A:)
mfkyeeivlergnsglgfsiaggidnphvpddpgifitkiipggaaamdgrlgvndcvlr
vnevdvsevvhsravealkeagpvvrlvvrrrqpppeetsv
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2i1nB (B:)
smfkyeeivlergnsglgfsiaggidnphvpddpgifitkiipggaaamdgrlgvndcvl
rvnevdvsevvhsravealkeagpvvrlvvrrrqpppeetsv