PDB entry 2hts

View 2hts on RCSB PDB site
Description: crystal structure of the DNA binding domain of the heat shock transcription factor
Class: transcription factor
Keywords: transcription factor
Deposited on 1994-06-02, released 1995-02-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.187
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat-shock transcription factor
    Species: KLUYVEROMYCES LACTIS [TaxId:28985]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2htsa_
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2htsA (A:)
arpafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrql
nmygwhkvqdvksgsmlsnndsrwefenerha

    Sequence, based on observed residues (ATOM records): (download) 
    >2htsA (A:)
arpafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrql
nmygwhkvqdvksgsndsrwefenerha