PDB entry 2hsn
View 2hsn on RCSB PDB site
Description: Structural basis of yeast aminoacyl-tRNA synthetase complex formation revealed by crystal structures of two binary sub-complexes
Class: Ligase/RNA Binding Protein
Keywords: protein complex protein interaction GST-fold, Ligase/RNA Binding Protein COMPLEX
Deposited on
2006-07-22, released
2006-09-05
The last revision prior to the SCOPe 2.04 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.228
AEROSPACI score: 0.34
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Methionyl-tRNA synthetase, cytoplasmic
Species: Saccharomyces cerevisiae [TaxId:4932]
Gene: MES1
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: GU4 nucleic-binding protein 1
Species: Saccharomyces cerevisiae [TaxId:4932]
Gene: ARC1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d2hsnb_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence, based on SEQRES records: (download)
>2hsnB (B:)
msdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivst
lyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklein
hd
Sequence, based on observed residues (ATOM records): (download)
>2hsnB (B:)
msdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivst
lyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklein