PDB entry 2hoe

View 2hoe on RCSB PDB site
Description: Crystal structure of N-acetylglucosamine kinase (TM1224) from Thermotoga maritima at 2.46 A resolution
Class: transferase
Keywords: TM1224, N-acetylglucosamine kinase (EC 2.7.1.59), Structural Genomics, PSI-2, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG, TRANSFERASE
Deposited on 2006-07-14, released 2006-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acetylglucosamine kinase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1224
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0V1 (Start-379)
      • modified residue (29)
      • modified residue (107)
      • modified residue (130)
      • modified residue (140-141)
      • modified residue (199)
      • modified residue (274)
      • modified residue (350)
    Domains in SCOPe 2.07: d2hoea1, d2hoea2, d2hoea3
  • Heterogens: K, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hoeA (A:)
    mgsdkihhhhhhmpksvraenisrilkrimkspvsrvelaeelgltkttvgeiakiflek
    givveekdspkgvgrptkslkispncayvlgievtrdeiaaclidasmnilaheahplps
    qsdreetlnvmyriidrakdmmeklgsklsaltvaapgpidtergiiidprnfplsqipl
    anllkekygievwvendadmgavgekwytkrddsfawiltgkgigagiiidgelyrgeng
    yageigytrvfngneyvfledvcnenvvlkhvlsmgfsslaeardsgdvrvkeyfddiar
    yfsigllnlihlfgiskiviggffkelgenflkkikievethllykhsvdmsfskvqepv
    iafgaavhalenylervtts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hoeA (A:)
    isrilkrimkspvsrvelaeelgltkttvgeiakiflekgivveekdsprptkslkispn
    cayvlgievtrdeiaaclidasmnilaheahplpsqsdreetlnvmyriidrakdmmekl
    gsklsaltvaapgpidtergiiidprnfplsqiplanllkekygievwvendadmgavge
    kwytkrddsfawiltgkgigagiiidgelyrgengyageigytrvfngneyvfledvcne
    nvvlkhvlsmgfslaeardsgdvrvkeyfddiaryfsigllnlihlfgiskiviggffke
    lgenflkkikievethllykhsvdmsfskvqepviafgaavhalenylervtts