![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.10: ROK [110636] (8 proteins) Pfam PF00480 |
![]() | Protein N-acetylglucosamine kinase [142469] (1 species) Transcriptional regulator, XylR-related |
![]() | Species Thermotoga maritima [TaxId:2336] [142470] (1 PDB entry) Uniprot Q9X0V1 200-368! Uniprot Q9X0V1 72-199 TM1224 |
![]() | Domain d2hoea2: 2hoe A:200-368 [136640] Other proteins in same PDB: d2hoea1 complexed with gol, k |
PDB Entry: 2hoe (more details), 2.46 Å
SCOPe Domain Sequences for d2hoea2:
Sequence, based on SEQRES records: (download)
>d2hoea2 c.55.1.10 (A:200-368) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} ddsfawiltgkgigagiiidgelyrgengyageigytrvfngneyvfledvcnenvvlkh vlsmgfsslaeardsgdvrvkeyfddiaryfsigllnlihlfgiskiviggffkelgenf lkkikievethllykhsvdmsfskvqepviafgaavhalenylervtts
>d2hoea2 c.55.1.10 (A:200-368) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} ddsfawiltgkgigagiiidgelyrgengyageigytrvfngneyvfledvcnenvvlkh vlsmgfslaeardsgdvrvkeyfddiaryfsigllnlihlfgiskiviggffkelgenfl kkikievethllykhsvdmsfskvqepviafgaavhalenylervtts
Timeline for d2hoea2: