PDB entry 2hod

View 2hod on RCSB PDB site
Description: Crystal Structure of Fragment D from Human Fibrinogen Complexed with Gly-hydroxyPro-Arg-Pro-amide
Class: blood clotting/peptide
Keywords: Knob-hole interactions, BLOOD CLOTTING-PEPTIDE complex
Deposited on 2006-07-14, released 2007-05-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibrinogen alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2hoda1
  • Chain 'B':
    Compound: fibrinogen beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Fibrinogen, gamma polypeptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: fibrinogen alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2hodd1
  • Chain 'E':
    Compound: fibrinogen beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Fibrinogen, gamma polypeptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: fibrinogen alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2hodg1
  • Chain 'H':
    Compound: fibrinogen beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Fibrinogen, gamma polypeptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: fibrinogen alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2hodj1
  • Chain 'K':
    Compound: fibrinogen beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Fibrinogen, gamma polypeptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Gly-hydroxyPro-Arg-Pro-amide peptide ligand
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2HOD (0-End)
  • Chain 'N':
    Compound: Gly-hydroxyPro-Arg-Pro-amide peptide ligand
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2HOD (0-End)
  • Chain 'O':
    Compound: Gly-hydroxyPro-Arg-Pro-amide peptide ligand
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2HOD (0-End)
  • Chain 'P':
    Compound: Gly-hydroxyPro-Arg-Pro-amide peptide ligand
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2HOD (0-End)
  • Chain 'Q':
    Compound: Gly-hydroxyPro-Arg-Pro-amide peptide ligand
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2HOD (0-End)
  • Chain 'R':
    Compound: Gly-hydroxyPro-Arg-Pro-amide peptide ligand
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2HOD (0-End)
  • Chain 'S':
    Compound: Gly-hydroxyPro-Arg-Pro-amide peptide ligand
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2HOD (0-End)
  • Chain 'T':
    Compound: Gly-hydroxyPro-Arg-Pro-amide peptide ligand
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2HOD (0-End)
  • Heterogens: NAG, CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2hodA (A:)
vsedlrsrievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsrala
revdlkdyedqqkqleqviakdllpsr

    Sequence, based on observed residues (ATOM records): (download) 
    >2hodA (A:)
ievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdy
edqqkqleqviakd

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >2hodD (D:)
vsedlrsrievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsrala
revdlkdyedqqkqleqviakdllpsr

    Sequence, based on observed residues (ATOM records): (download) 
    >2hodD (D:)
lkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedq
qkqleqviakd

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download) 
    >2hodG (G:)
vsedlrsrievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsrala
revdlkdyedqqkqleqviakdllpsr

    Sequence, based on observed residues (ATOM records): (download) 
    >2hodG (G:)
ievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdy
edqqkqleqviakd

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download) 
    >2hodJ (J:)
vsedlrsrievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsrala
revdlkdyedqqkqleqviakdllpsr

    Sequence, based on observed residues (ATOM records): (download) 
    >2hodJ (J:)
dlrsrievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarev
dlkdyedqqkqleqviakd

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.