![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) ![]() |
![]() | Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
![]() | Protein Fibrinogen alpha chain [88887] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88889] (22 PDB entries) Uniprot P02671 150-209 |
![]() | Domain d2hoda1: 2hod A:126-192 [136635] automatically matched to 2H43 A:126-195 complexed with ca, nag |
PDB Entry: 2hod (more details), 2.9 Å
SCOPe Domain Sequences for d2hoda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hoda1 h.1.8.1 (A:126-192) Fibrinogen alpha chain {Human (Homo sapiens) [TaxId: 9606]} viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql eqviakd
Timeline for d2hoda1: