PDB entry 2hnu

View 2hnu on RCSB PDB site
Description: Crystal Structure of a Dipeptide Complex of Bovine Neurophysin-I
Class: peptide binding protein
Keywords: Neurophysin, ligand-facilitated dimerization, inter-domain loop, amino-terminus, subunit interface, hydrogen bonding, PEPTIDE BINDING PROTEIN
Deposited on 2006-07-13, released 2007-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Oxytocin-neurophysin 1
  Species: Bos taurus [TaxId:9913]
  Gene: OXT
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01175 (0-80)
  Domains in SCOPe 2.07: d2hnua_
• Chain 'B':
  Compound: Oxytocin-neurophysin 1
  Species: Bos taurus [TaxId:9913]
  Gene: OXT
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01175 (0-80)
  Domains in SCOPe 2.07: d2hnub_
• Chain 'C':
  Compound: Oxytocin-neurophysin 1
  Species: Bos taurus [TaxId:9913]
  Gene: OXT
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01175 (0-80)
  Domains in SCOPe 2.07: d2hnuc_
• Chain 'D':
  Compound: Oxytocin-neurophysin 1
  Species: Bos taurus [TaxId:9913]
  Gene: OXT
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01175 (0-80)
  Domains in SCOPe 2.07: d2hnud_
• Chain 'E':
  Compound: Oxytocin-neurophysin 1
  Species: Bos taurus [TaxId:9913]
  Gene: OXT
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01175 (0-80)
  Domains in SCOPe 2.07: d2hnue_
• Heterogens: PHE, TYR, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hnuA (A:)
  vrtclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkpcgsggr
  caaagiccspdgchedpacdp
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hnuB (B:)
  vrtclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkpcgsggr
  caaagiccspdgchedpacdp
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hnuC (C:)
  vrtclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkpcgsggr
  caaagiccspdgchedpacdp
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hnuD (D:)
  vrtclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkpcgsggr
  caaagiccspdgchedpacdp
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hnuE (E:)
  vrtclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkpcgsggr
  caaagiccspdgchedpacdp