PDB entry 2hng

View 2hng on RCSB PDB site
Description: The Crystal Structure of Protein of Unknown Function SP1558 from Streptococcus pneumoniae
Class: structural genomics, unknown function
Keywords: alpha-beta, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2006-07-12, released 2006-08-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.193
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Gene: SP_1558
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97PP5 (3-126)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (60)
      • modified residue (104)
    Domains in SCOPe 2.04: d2hnga1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2hngA (A:)
snamnlkreqefvsqyhfdarnfewenengapetkvdvnfqllqhdqenqvtslivilsf
mivfdkfvisgtisqvnhidgrivnepselnqeevetlarpclnmlnrltyevteialdl
pginlef

    Sequence, based on observed residues (ATOM records): (download) 
    >2hngA (A:)
amnlkreqefvsqyhfdarnfewenengapetkvdvnfqllqhdqenqvtslivilsfmi
vfdkfvisgtisqvnhidgrivnepselnqeevetlarpclnmlnrltyevteialdlpg
inlef