PDB entry 2hir

View 2hir on RCSB PDB site
Description: solution structure of recombinant hirudin and the lys-47 (right arrow) glu mutant. a nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing study
Deposited on 1988-12-19, released 1990-01-15
The last revision prior to the SCOP 1.63 freeze date was dated 1990-01-15, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d2hir__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hir_ (-)
    vvytdctesgqnlclcegsnvcgqgnkcilgsdgeknqcvtgegtpkpq