PDB entry 2hip

View 2hip on RCSB PDB site
Description: the molecular structure of the high potential iron-sulfur protein isolated from ectothiorhodospira halophila determined at 2.5-angstroms resolution
Deposited on 1991-06-24, released 1992-07-15
The last revision prior to the SCOP 1.61 freeze date was dated 1992-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.184
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d2hipa_
  • Chain 'B':
    Domains in SCOP 1.61: d2hipb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hipA (A:)
    epraedghahdyvneaadasghpryqegqlcencafwgeavqdgwgrcthpdfdevlvka
    egwcsvyapas
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hipB (B:)
    epraedghahdyvneaadasghpryqegqlcencafwgeavqdgwgrcthpdfdevlvka
    egwcsvyapas