PDB entry 2hch

View 2hch on RCSB PDB site
Description: N-Domain Of Grp94 In Complex With the Novel Ligand N-(2-amino)ethyl Carboxyamido Adenosine
Class: chaperone
Keywords: GRP94, HSP82, HSP90, HTPG, chaperone, ligand, NECA, NPCA, NEaCA, NEoCA, adenosine
Deposited on 2006-06-16, released 2007-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmin
    Species: Canis lupus [TaxId:9615]
    Gene: HSP90B1, TRA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41148 (4-End)
      • cloning artifact (0-3)
    • Uniprot P41148 (Start-235)
    Domains in SCOPe 2.07: d2hcha2, d2hcha3
  • Chain 'B':
    Compound: Endoplasmin
    Species: Canis lupus [TaxId:9615]
    Gene: HSP90B1, TRA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41148 (4-End)
      • cloning artifact (0-3)
    • Uniprot P41148 (Start-235)
    Domains in SCOPe 2.07: d2hchb2, d2hchb3
  • Heterogens: N5A, PG4, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hchA (A:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hchA (A:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtigtseflnkmtestselig
    qfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlke
    easdyleldtiknlvkkysqfinfpiyvwssktvwdwelmn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hchB (B:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hchB (B:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtigtseflnkstseligqfg
    vgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlkeeas
    dyleldtiknlvkkysqfinfpiyvwssktvwdwelmn