SCOPe 2.08: Domain d2hchb2: 2hch B:69-337

Lineage for d2hchb2 (2hch B:69-337)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein HSP90 [55876] (3 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [103225] (33 PDB entries)
   Uniprot P41148 76-285; Endoplasmin, GRP94

8. Domain d2hchb2: 2hch B:69-337 [136335]
   Other proteins in same PDB: d2hcha3, d2hchb3
   automated match to d1u2oa_
   complexed with 1pe, n5a, pg4

Details for d2hchb2

PDB Entry: 2hch, 2.3 Å

PDB Description: n-domain of grp94 in complex with the novel ligand n-(2-amino)ethyl carboxyamido adenosine

PDB Compounds: (B:) Endoplasmin

SCOPe Domain Sequences for d2hchb2:

Sequence, based on SEQRES records:

>d2hchb2 d.122.1.1 (B:69-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
lreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalag
neeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqst
seligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttit
lvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn

Sequence, based on observed residues (ATOM records):

>d2hchb2 d.122.1.1 (B:69-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
lreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalag
neeltvkikcdkeknllhvtdtgvgmtreelvknlgtigtseflnkstseligqfgvgfy
saflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlkeeasdyle
ldtiknlvkkysqfinfpiyvwssktvwdwelmn

Timeline for d2hchb2:

• d2hchb2 first appeared in SCOP 1.73, called d2hchb1
  
• d2hchb2 appears in SCOPe 2.07