PDB entry 2hbg

View 2hbg on RCSB PDB site
Description: glycera dibranchiata hemoglobin. structure and refinement at 1.5 angstroms resolution
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1991-02-11, released 1992-07-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.127
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin (deoxy)
    Species: Glycera dibranchiata [TaxId:6350]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02216 (0-146)
      • conflict (28)
    Domains in SCOPe 2.06: d2hbga_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hbgA (A:)
    glsaaqrqviaatwkdiagadngagvgkkclikflsahpqmaavfgfsgasdpgvaalga
    kvlaqigvavshlgdegkmvaqmkavgvrhkgygnkhikaqyfeplgasllsamehrigg
    kmnaaakdawaaayadisgalisglqs