PDB entry 2hbg

View 2hbg on RCSB PDB site
Description: glycera dibranchiata hemoglobin. structure and refinement at 1.5 angstroms resolution
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1991-02-11, released 1992-07-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.127
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hemoglobin (deoxy)
  Species: Glycera dibranchiata [TaxId:6350]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02216 (0-146)
    • conflict (28)
  Domains in SCOPe 2.02: d2hbga_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hbgA (A:)
  glsaaqrqviaatwkdiagadngagvgkkclikflsahpqmaavfgfsgasdpgvaalga
  kvlaqigvavshlgdegkmvaqmkavgvrhkgygnkhikaqyfeplgasllsamehrigg
  kmnaaakdawaaayadisgalisglqs