PDB entry 2hap

View 2hap on RCSB PDB site
Description: structure of a hap1-18/dna complex reveals that protein/dna interactions can have direct allosteric effects on transcriptional activation
Deposited on 1998-09-17, released 1999-05-18
The last revision prior to the SCOP 1.59 freeze date was dated 1999-05-18, with a file datestamp of 1999-05-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.248
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hapC (C:)
    rkrnriplrcticrkrkvkcdklrphcqqctktgvahlchymeqtwaeeaekellkdnel
    kklrervkslektlsk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hapD (D:)
    krnriplrcticrkrkvkcdklrphcqqctktgvahlchymeqtwaeeaekellkdnevk
    klrervkslektlsk